CHN1 anticorps
-
- Antigène Voir toutes CHN1 (ARHGAP2) Anticorps
- CHN1 (ARHGAP2) (rho GTPase Activating Protein 2 (ARHGAP2))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CHN1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- CHN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KVYSCDLTTLVKAHTTKRPMVVDMCIREIESRGLNSEGLYRVSGFSDLIE
- Top Product
- Discover our top product ARHGAP2 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CHN1 Blocking Peptide, catalog no. 33R-4728, is also available for use as a blocking control in assays to test for specificity of this CHN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CHN1 (ARHGAP2) (rho GTPase Activating Protein 2 (ARHGAP2))
- Autre désignation
- CHN1 (ARHGAP2 Produits)
- Synonymes
- anticorps ARHGAP2, anticorps CHN, anticorps DURS2, anticorps NC, anticorps RHOGAP2, anticorps 0610007I19Rik, anticorps 0710001E19Rik, anticorps 1700112L09Rik, anticorps 2900046J01Rik, anticorps AI413815, anticorps chimaerin, anticorps wu:fr89a09, anticorps zgc:56160, anticorps zgc:92906, anticorps N-chimaerin, anticorps chimerin 1, anticorps chimerin 1 L homeolog, anticorps CHN1, anticorps Chn1, anticorps chn1.L, anticorps chn1
- Sujet
- CHN1 contains 1 phorbol-ester/DAG-type zinc finger, 1 Rho-GAP domain and 1 SH2 domain. CHN1 is a GTPase-activating protein for p21-rac and a phorbol ester receptor. It may play an important role in neuronal signal-transduction mechanisms.
- Poids moléculaire
- 53 kDa (MW of target protein)
-