C4BPA anticorps (Middle Region)
-
- Antigène Voir toutes C4BPA Anticorps
- C4BPA (Complement Component 4 Binding Protein, alpha (C4BPA))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp C4BPA est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C4 BPA antibody was raised against the middle region of C4 PA
- Purification
- Affinity purified
- Immunogène
- C4 BPA antibody was raised using the middle region of C4 PA corresponding to a region with amino acids QVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL
- Top Product
- Discover our top product C4BPA Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C4BPA Blocking Peptide, catalog no. 33R-7781, is also available for use as a blocking control in assays to test for specificity of this C4BPA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 PA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- C4BPA (Complement Component 4 Binding Protein, alpha (C4BPA))
- Autre désignation
- C4BPA (C4BPA Produits)
- Synonymes
- anticorps CRES, anticorps c4bp, anticorps C4BP, anticorps PRP, anticorps complement component 4 binding protein, alpha chain, anticorps C4b-binding protein alpha chain, anticorps complement component 4 binding protein alpha, anticorps complement component 4 binding protein, alpha, anticorps LOC419851, anticorps c4bp, anticorps C4BPA, anticorps C4bpa
- Sujet
- C4BPA is a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. Along with a single, unique beta-chain, seven identical alpha-chains encoded by this gene assemble into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster.
- Poids moléculaire
- 62 kDa (MW of target protein)
- Pathways
- Système du Complément
-