STAMBP anticorps (N-Term)
-
- Antigène Voir toutes STAMBP Anticorps
- STAMBP (STAM Binding Protein (STAMBP))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp STAMBP est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- STAMBP antibody was raised against the N terminal of STAMBP
- Purification
- Affinity purified
- Immunogène
- STAMBP antibody was raised using the N terminal of STAMBP corresponding to a region with amino acids SDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYS
- Top Product
- Discover our top product STAMBP Anticorps primaire
-
anti-STAM Binding Protein (STAMBP) antibody
STAMBP Reactivité: Humain, Souris, Rat WB, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-STAM Binding Protein (STAMBP) (AA 100-270) antibodySTAMBP Reactivité: Humain WB, IHC, IF, IP Hôte: Lapin Polyclonal unconjugated
anti-STAM Binding Protein (STAMBP) (AA 1-424) antibodySTAMBP Reactivité: Humain WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-STAM Binding Protein (STAMBP) (AA 355-383), (C-Term) antibodySTAMBP Reactivité: Humain, Souris WB, IHC (p) Hôte: Lapin Polyclonal RB32017 unconjugated
anti-STAM Binding Protein (STAMBP) (AA 1-424) antibodySTAMBP Reactivité: Humain WB Hôte: Souris Polyclonal unconjugated
anti-STAM Binding Protein (STAMBP) (AA 1-424) antibodySTAMBP Reactivité: Humain ELISA, IF Hôte: Souris Monoclonal 1A8 unconjugated
anti-STAM Binding Protein (STAMBP) antibodySTAMBP Reactivité: Humain, Souris, Rat WB, IHC, IF, IC Hôte: Lapin Polyclonal unconjugated
anti-STAM Binding Protein (STAMBP) (AA 362-391), (C-Term) antibodySTAMBP Reactivité: Humain, Souris WB, IHC (p), EIA Hôte: Lapin Polyclonal unconjugated
anti-STAM Binding Protein (STAMBP) (C-Term) antibodySTAMBP Reactivité: Humain, Souris, Rat WB, ELISA Hôte: Lapin Polyclonal unconjugated
anti-STAM Binding Protein (STAMBP) antibodySTAMBP Reactivité: Humain WB Hôte: Lapin Monoclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
STAMBP Blocking Peptide, catalog no. 33R-8355, is also available for use as a blocking control in assays to test for specificity of this STAMBP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STAMBP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- STAMBP (STAM Binding Protein (STAMBP))
- Autre désignation
- STAMBP (STAMBP Produits)
- Synonymes
- anticorps AMSH, anticorps 5330424L14Rik, anticorps 5730422L11Rik, anticorps AW107289, anticorps Amsh, anticorps mKIAA4198, anticorps stambp, anticorps zgc:66147, anticorps STAM binding protein, anticorps Stam binding protein, anticorps STAM binding protein a, anticorps STAMBP, anticorps Stambp, anticorps stambpa
- Sujet
- Cytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. STAMBP binds to the SH3 domain of the signal-transducing adaptor molecule, and plays a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression.
- Poids moléculaire
- 48 kDa (MW of target protein)
-
