C4B anticorps
-
- Antigène Voir toutes C4B (C4b) Anticorps
- C4B (C4b) (Complement Component C4b (C4b))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp C4B est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- Complement C4 b antibody was raised using a synthetic peptide corresponding to a region with amino acids QTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYM
- Top Product
- Discover our top product C4b Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Complement C4b Blocking Peptide, catalog no. 33R-7746, is also available for use as a blocking control in assays to test for specificity of this Complement C4b antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- C4B (C4b) (Complement Component C4b (C4b))
- Autre désignation
- Complement C4b (C4b Produits)
- Synonymes
- anticorps C4B1, anticorps C4B12, anticorps C4B2, anticorps C4B3, anticorps C4B5, anticorps C4BD, anticorps C4B_2, anticorps C4F, anticorps CH, anticorps CO4, anticorps CPAMD3, anticorps C4, anticorps C4A2, anticorps C4A3, anticorps C4A4, anticorps C4A6, anticorps C4AD, anticorps C4S, anticorps CPAMD2, anticorps RG, anticorps wu:fi14a03, anticorps C4B, anticorps DKFZP469I0332, anticorps Slp, anticorps Ss, anticorps C4-2, anticorps C4l, anticorps complement C4B (Chido blood group), anticorps complement C4A (Rodgers blood group), anticorps complement component 4, anticorps complement C4-B, anticorps complement component 4B (Chido blood group), anticorps complement component 4A (Rodgers blood group), anticorps C4B, anticorps C4A, anticorps c4, anticorps LOC462577, anticorps C4a, anticorps C4b
- Sujet
- C4B is the basic form of complement factor 4, part of the classical activation pathway. The protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains prior to secretion. The trimer provides a surface for interaction between the antigen-antibody complex and other complement components. The alpha chain may be cleaved to release C4 anaphylatoxin, a mediator of local inflammation. Deficiency of this protein is associated with systemic lupus erythematosus. This gene encodes the basic form of complement factor 4, part of the classical activation pathway.
- Poids moléculaire
- 33 kDa (MW of target protein)
- Pathways
- Système du Complément
-