UBD anticorps (N-Term)

N° du produit ABIN634317

Détail du produit anti-UBD anticorps

Antigène: UBD (Ubiquitin D (UBD))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBD est non-conjugé

Application: Western Blotting (WB)

Specificité: Ubiquitin D antibody was raised against the N terminal of UBD

Purification: Affinity purified

Immunogène: Ubiquitin D antibody was raised using the N terminal of UBD corresponding to a region with amino acids RSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Ubiquitin D Blocking Peptide, catalog no. 33R-8192, is also available for use as a blocking control in assays to test for specificity of this Ubiquitin D antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBD

Antigène: UBD (Ubiquitin D (UBD))

Autre désignation: Ubiquitin D (UBD Produits)

Synonymes: anticorps FAT10, anticorps GABBR1, anticorps UBD-3, anticorps ubiquitin D, anticorps UBD, anticorps Ubd

Sujet: UBD qualifies as a marker for an interferon response in hepatocellular carcinoma and colon carcinoma but is not significantly overexpressed in cancers lacking a proinflammatory environment. Immunohistochemical studies demonstrated increased UBD expression in HIV-associated nephropathy and in autosomal dominant polycystic kidney disease.

Poids moléculaire: 18 kDa (MW of target protein)

Pathways: Ubiquitin Proteasome Pathway