SNX5 anticorps (N-Term)
-
- Antigène Voir toutes SNX5 Anticorps
- SNX5 (Sorting Nexin 5 (SNX5))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SNX5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SNX5 antibody was raised against the N terminal of SNX5
- Purification
- Affinity purified
- Immunogène
- SNX5 antibody was raised using the N terminal of SNX5 corresponding to a region with amino acids FVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEF
- Top Product
- Discover our top product SNX5 Anticorps primaire
-
anti-Sorting Nexin 5 (SNX5) (AA 7-245) antibody
SNX5 Reactivité: Humain WB, ELISA, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Sorting Nexin 5 (SNX5) antibodySNX5 Reactivité: Humain, Souris, Rat WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Sorting Nexin 5 (SNX5) (C-Term) antibodyVerified SNX5 Reactivité: Humain WB, ELISA, IHC Hôte: Chèvre Polyclonal unconjugated
anti-Sorting Nexin 5 (SNX5) (AA 43-70), (N-Term) antibodySNX5 Reactivité: Humain WB Hôte: Lapin Polyclonal RB42916 unconjugated
anti-Sorting Nexin 5 (SNX5) antibodySNX5 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-Sorting Nexin 5 (SNX5) (AA 145-404) antibodySNX5 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-Sorting Nexin 5 (SNX5) (C-Term) antibody (Biotin)Verified SNX5 Reactivité: Humain WB, ELISA, IHC Hôte: Chèvre Polyclonal Biotin
anti-Sorting Nexin 5 (SNX5) (AA 31-80) antibodySNX5 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Porc, Cheval, Lapin, Poisson zèbre (Danio rerio), Singe, Cobaye, Poulet WB Hôte: Lapin Polyclonal unconjugated
anti-Sorting Nexin 5 (SNX5) (AA 72-121) antibodySNX5 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Porc, Cheval, Lapin, Poisson zèbre (Danio rerio), Singe, Roussette (Chauve-souris) WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SNX5 Blocking Peptide, catalog no. 33R-3126, is also available for use as a blocking control in assays to test for specificity of this SNX5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNX5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SNX5 (Sorting Nexin 5 (SNX5))
- Autre désignation
- SNX5 (SNX5 Produits)
- Synonymes
- anticorps 0910001N05Rik, anticorps 1810032P22Rik, anticorps AU019504, anticorps D2Ertd52e, anticorps id:ibd5091, anticorps wu:fa66c10, anticorps wu:fi28h04, anticorps zgc:55769, anticorps SNX5, anticorps snx5, anticorps sorting nexin 5, anticorps sorting nexin 5 S homeolog, anticorps SNX5, anticorps Snx5, anticorps snx5.S, anticorps snx5
- Sujet
- SNX5 is a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein binds to fanconi anemia complementation group A protein, but its function is unknown.
- Poids moléculaire
- 47 kDa (MW of target protein)
-
