NCF4 anticorps (Middle Region)
-
- Antigène Voir toutes NCF4 Anticorps
- NCF4 (Neutrophil Cytosolic Factor 4, 40kDa (NCF4))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NCF4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NCF4 antibody was raised against the middle region of NCF4
- Purification
- Affinity purified
- Immunogène
- NCF4 antibody was raised using the middle region of NCF4 corresponding to a region with amino acids TGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKSVAWEGGACPAF
- Top Product
- Discover our top product NCF4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NCF4 Blocking Peptide, catalog no. 33R-9086, is also available for use as a blocking control in assays to test for specificity of this NCF4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCF4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NCF4 (Neutrophil Cytosolic Factor 4, 40kDa (NCF4))
- Autre désignation
- NCF4 (NCF4 Produits)
- Synonymes
- anticorps p40phox, anticorps AI451400, anticorps NCF, anticorps P40PHOX, anticorps SH3PXD4, anticorps neutrophil cytosolic factor 4, anticorps ncf4, anticorps Ncf4, anticorps NCF4
- Sujet
- NCF4 is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling event.
- Poids moléculaire
- 39 kDa (MW of target protein)
-