RGS19 anticorps (N-Term)
-
- Antigène Voir toutes RGS19 Anticorps
- RGS19 (Regulator of G-Protein Signalling 19 (RGS19))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RGS19 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RGS19 antibody was raised against the N terminal of RGS19
- Purification
- Affinity purified
- Immunogène
- RGS19 antibody was raised using the N terminal of RGS19 corresponding to a region with amino acids PTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSW
- Top Product
- Discover our top product RGS19 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RGS19 Blocking Peptide, catalog no. 33R-7391, is also available for use as a blocking control in assays to test for specificity of this RGS19 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS19 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RGS19 (Regulator of G-Protein Signalling 19 (RGS19))
- Autre désignation
- RGS19 (RGS19 Produits)
- Synonymes
- anticorps RGS19, anticorps GAIP, anticorps RGSGAIP, anticorps 2610042F04Rik, anticorps AI324841, anticorps AW547781, anticorps Camki, anticorps Gaip, anticorps regulator of G protein signaling 19, anticorps regulator of G-protein signaling 19, anticorps RGS19, anticorps Rgs19
- Sujet
- G proteins mediate a number of cellular processes. RGS19 belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling.G proteins mediate a number of cellular processes.
- Poids moléculaire
- 25 kDa (MW of target protein)
- Pathways
- Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling
-