SHB anticorps (N-Term)
-
- Antigène Voir toutes SHB Anticorps
- SHB (Src Homology 2 Domain Containing Adaptor Protein B (SHB))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SHB est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SHB antibody was raised against the N terminal of SHB
- Purification
- Affinity purified
- Immunogène
- SHB antibody was raised using the N terminal of SHB corresponding to a region with amino acids ERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAY
- Top Product
- Discover our top product SHB Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SHB Blocking Peptide, catalog no. 33R-2710, is also available for use as a blocking control in assays to test for specificity of this SHB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SHB (Src Homology 2 Domain Containing Adaptor Protein B (SHB))
- Autre désignation
- SHB (SHB Produits)
- Sujet
- SHB is the adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. SHB may play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling. SHB may also play a role in T-cell antigen receptor/TCR signaling, interleukin-2 signaling, apoptosis and neuronal cells differentiation by mediating basic-FGF and NGF-induced signaling cascades. SHB may also regulate IRS1 and IRS2 signaling in insulin-producing cells.
- Poids moléculaire
- 55 kDa (MW of target protein)
-