-
- Antigène Voir toutes SNX18 Anticorps
- SNX18 (Sorting Nexin 18 (SNX18))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SNX18 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SNAG1 antibody was raised against the N terminal Of Snag1
- Purification
- Affinity purified
- Immunogène
- SNAG1 antibody was raised using the N terminal Of Snag1 corresponding to a region with amino acids LLQPQQAPPPSTFQPPGAGFPYGGGALQPSPQQLYGGYQASQGSDDDWDD
- Top Product
- Discover our top product SNX18 Anticorps primaire
-
anti-Sorting Nexin 18 (SNX18) (C-Term) antibody
KO Validated SNX18 Reactivité: Humain WB, IHC (p), ICC, IF Hôte: Lapin Polyclonal unconjugated
anti-Sorting Nexin 18 (SNX18) (AA 449-628) antibodySNX18 Reactivité: Humain WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Sorting Nexin 18 (SNX18) (AA 411-614) antibodySNX18 Reactivité: Souris WB, IHC, ICC Hôte: Lapin Polyclonal unconjugated
anti-Sorting Nexin 18 (SNX18) (AA 485-514), (C-Term) antibodySNX18 Reactivité: Humain WB Hôte: Lapin Polyclonal RB37202 unconjugated
anti-Sorting Nexin 18 (SNX18) (AA 445-624) antibodySNX18 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-Sorting Nexin 18 (SNX18) (C-Term) antibodyVerified SNX18 Reactivité: Humain WB, ELISA Hôte: Chèvre Polyclonal unconjugated
anti-Sorting Nexin 18 (SNX18) (AA 371-420) antibodySNX18 Reactivité: Humain, Souris, Rat, Chien, Cobaye, Boeuf (Vache), Cheval, Lapin, Singe, Porc, Poulet WB Hôte: Lapin Polyclonal unconjugated
anti-Sorting Nexin 18 (SNX18) (AA 492-541) antibodySNX18 Reactivité: Humain, Souris, Rat, Chien, Cobaye, Boeuf (Vache), Lapin, Singe, Porc WB Hôte: Lapin Polyclonal unconjugated
anti-Sorting Nexin 18 (SNX18) (AA 107-156) antibodySNX18 Reactivité: Humain, Souris, Rat, Singe WB Hôte: Lapin Polyclonal unconjugated
anti-Sorting Nexin 18 (SNX18) (Middle Region) antibodySNX18 Reactivité: Humain, Souris, Rat, Chien, Cobaye, Boeuf (Vache), Cheval, Lapin, Poisson zèbre (Danio rerio) WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SNAG1 Blocking Peptide, catalog no. 33R-5183, is also available for use as a blocking control in assays to test for specificity of this SNAG1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNAG1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SNX18 (Sorting Nexin 18 (SNX18))
- Autre désignation
- SNAG1 (SNX18 Produits)
- Synonymes
- anticorps snag1, anticorps MGC82637, anticorps SNX18, anticorps SNAG1, anticorps si:dkey-193c22.4, anticorps SH3PX2, anticorps SH3PXD3B, anticorps Snag1, anticorps sorting nexin 18 L homeolog, anticorps sorting nexin 18, anticorps sorting nexin 18 S homeolog, anticorps sorting nexin 18a, anticorps snx18.L, anticorps SNX18, anticorps snx18.S, anticorps snx18, anticorps snx18a, anticorps Snx18
- Sujet
- This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking.
- Poids moléculaire
- 69 kDa (MW of target protein)
-
Vous êtes ici:
