RHOD anticorps (N-Term)

N° du produit ABIN634338

Détail du produit anti-RHOD anticorps

Antigène: RHOD (Ras Homolog Family Member D (RHOD))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RHOD est non-conjugé

Application: Western Blotting (WB)

Specificité: RHOD antibody was raised against the N terminal of RHOD

Purification: Affinity purified

Immunogène: RHOD antibody was raised using the N terminal of RHOD corresponding to a region with amino acids TAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RHOD Blocking Peptide, catalog no. 33R-8964, is also available for use as a blocking control in assays to test for specificity of this RHOD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RHOD

Antigène: RHOD (Ras Homolog Family Member D (RHOD))

Autre désignation: RHOD (RHOD Produits)

Synonymes: anticorps ARHD, anticorps RHOHP1, anticorps RHOM, anticorps Rho, anticorps AI326383, anticorps Arhd, anticorps RhoHP1, anticorps RhoM, anticorps ras homolog family member D, anticorps RHOD, anticorps Rhod

Sujet: Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation. RHOD binds GTP and is a member of the small GTPase superfamily. It is involved in endosome dynamics and reorganization of the actin cytoskeleton, and it may coordinate membrane transport with the function of the cytoskeleton. Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation.

Poids moléculaire: 23 kDa (MW of target protein)