WNK3 anticorps (N-Term)

N° du produit ABIN634341

Détail du produit anti-WNK3 anticorps

Antigène: WNK3 (WNK Lysine Deficient Protein Kinase 3 (WNK3))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WNK3 est non-conjugé

Application: Western Blotting (WB)

Specificité: WNK3 antibody was raised against the N terminal of WNK3

Purification: Affinity purified

Immunogène: WNK3 antibody was raised using the N terminal of WNK3 corresponding to a region with amino acids WVEDPKKLKGKHKDNEAIEFSFNLETDTPEEVAYEMVKSGFFHESDSKAV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WNK3 Blocking Peptide, catalog no. 33R-10032, is also available for use as a blocking control in assays to test for specificity of this WNK3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNK3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WNK3

Antigène: WNK3 (WNK Lysine Deficient Protein Kinase 3 (WNK3))

Autre désignation: WNK3 (WNK3 Produits)

Synonymes: anticorps fc63h12, anticorps PRKWNK3, anticorps Prkwnk3, anticorps Wnk3-ps, anticorps RGD1563131, anticorps wu:fc63h12, anticorps WNK lysine deficient protein kinase 3, anticorps wu:fc63h12, anticorps LOC100363278, anticorps WNK3, anticorps Wnk3

Sujet: Members of the 'with no lysine' (WNK) kinase family, such as WNK3, are serine-threonine protein kinases that lack the almost invariant catalytic lysine in subdomain II, which is important for binding ATP in the catalytic site.

Poids moléculaire: 192 kDa (MW of target protein)