STK38 anticorps (C-Term)
-
- Antigène Voir toutes STK38 Anticorps
- STK38 (serine/threonine Kinase 38 (STK38))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp STK38 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- STK38 antibody was raised against the C terminal of STK38
- Purification
- Affinity purified
- Immunogène
- STK38 antibody was raised using the C terminal of STK38 corresponding to a region with amino acids IGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESD
- Top Product
- Discover our top product STK38 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
STK38 Blocking Peptide, catalog no. 33R-3966, is also available for use as a blocking control in assays to test for specificity of this STK38 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STK38 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- STK38 (serine/threonine Kinase 38 (STK38))
- Autre désignation
- STK38 (STK38 Produits)
- Synonymes
- anticorps NDR, anticorps NDR1, anticorps 5830476G13Rik, anticorps 9530097A09Rik, anticorps AA617404, anticorps Ndr1, anticorps trc, anticorps si:ch1073-272h17.2, anticorps wu:fj80h03, anticorps zgc:55572, anticorps serine/threonine kinase 38, anticorps serine/threonine kinase 38 S homeolog, anticorps serine/threonine kinase 38b, anticorps serine/threonine kinase 38a, anticorps STK38, anticorps Stk38, anticorps stk38.S, anticorps stk38b, anticorps stk38a
- Sujet
- STK38 belongs to the protein kinase superfamily, AGC Ser/Thr protein kinase family. It contains 1 AGC-kinase C-terminal domain and 1 protein kinase domain. NDR-driven centrosome duplication requires Cdk2 activity and that Cdk2-induced centrosome amplification is affected upon reduction of NDR activity.
- Poids moléculaire
- 54 kDa (MW of target protein)
-