SH2D3C anticorps (N-Term)

N° du produit ABIN634344

Détail du produit anti-SH2D3C anticorps

Antigène: SH2D3C (SH2 Domain Containing 3C (SH2D3C))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SH2D3C est non-conjugé

Application: Western Blotting (WB)

Specificité: SH2 D2 antibody was raised against the N terminal of SH2 2

Purification: Affinity purified

Immunogène: SH2 D2 antibody was raised using the N terminal of SH2 2 corresponding to a region with amino acids AGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPRE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SH2D3C Blocking Peptide, catalog no. 33R-1220, is also available for use as a blocking control in assays to test for specificity of this SH2D3C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SH2D3C

Antigène: SH2D3C (SH2 Domain Containing 3C (SH2D3C))

Autre désignation: SH2D3C (SH2D3C Produits)

Synonymes: anticorps sh2d3c, anticorps zgc:56490, anticorps SH2D3C, anticorps CHAT, anticorps NSP3, anticorps PRO34088, anticorps SHEP1, anticorps Chat, anticorps Nsp3, anticorps Shep1, anticorps SH2 domain containing 3Cb, anticorps SH2 domain containing 3C, anticorps SH2 domain-containing protein 3C, anticorps SH2 domain containing 3C L homeolog, anticorps sh2d3cb, anticorps SH2D3C, anticorps LOC100466471, anticorps sh2d3c, anticorps sh2d3c.L, anticorps Sh2d3c

Sujet: SH2D3C is an Eph receptor-binding protein which may be a positive regulator of TCR signaling. Binding to BCAR1 of SH2D3C is required to induce membrane ruffling and promote EGF-dependent cell migration.

Poids moléculaire: 77 kDa (MW of target protein)