FES anticorps (N-Term)

N° du produit ABIN634347

Détail du produit anti-FES anticorps

Antigène: FES (Feline Sarcoma Oncogene (FES))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FES est non-conjugé

Application: Western Blotting (WB)

Specificité: FES antibody was raised against the N terminal of FES

Purification: Affinity purified

Immunogène: FES antibody was raised using the N terminal of FES corresponding to a region with amino acids ARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FES Blocking Peptide, catalog no. 33R-1466, is also available for use as a blocking control in assays to test for specificity of this FES antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FES antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FES

Antigène: FES (Feline Sarcoma Oncogene (FES))

Autre désignation: FES (FES Produits)

Synonymes: anticorps FPS, anticorps RGD1564385, anticorps AI586313, anticorps BB137047, anticorps c-fes, anticorps FES, anticorps c-fps, anticorps FES proto-oncogene, tyrosine kinase, anticorps feline sarcoma oncogene, anticorps FES, anticorps Fes, anticorps fes

Sujet: FES is the human cellular counterpart of a feline sarcoma retrovirus protein with transforming capabilities. FES has tyrosine-specific protein kinase activity and that activity is required for maintenance of cellular transformation. Its chromosomal location has linked it to a specific translocation event identified in patients with acute promyelocytic leukemia but it is also involved in normal hematopoiesis.

Poids moléculaire: 93 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Signaling Events mediated by VEGFR1 and VEGFR2