DVL2 anticorps
-
- Antigène Voir toutes DVL2 Anticorps
- DVL2 (Dishevelled, Dsh Homolog 2 (Drosophila) (DVL2))
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DVL2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DVL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPA
- Top Product
- Discover our top product DVL2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DVL2 Blocking Peptide, catalog no. 33R-1228, is also available for use as a blocking control in assays to test for specificity of this DVL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DVL2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DVL2 (Dishevelled, Dsh Homolog 2 (Drosophila) (DVL2))
- Autre désignation
- DVL2 (DVL2 Produits)
- Synonymes
- anticorps Xdsh, anticorps dishevelled, anticorps dsh, anticorps dvl, anticorps Dvl-2, anticorps xdsh, anticorps wu:fc05d12, anticorps wu:fo71e09, anticorps wu:fp54a02, anticorps zgc:55372, anticorps dishevelled segment polarity protein 2, anticorps dishevelled segment polarity protein 2 L homeolog, anticorps DVL2, anticorps dvl2, anticorps Dvl2, anticorps dvl2.L
- Sujet
- DVL2 is a member of the dishevelled (dsh) protein family. It is a 90 kDa protein that undergoes posttranslational phosphorylation to form a 95 kDa cytoplasmic protein, which may play a role in the signal transduction pathway mediated by multiple Wnt proteins. The mechanisms of dishevelled function in Wnt signaling are likely to be conserved among metazoans.
- Poids moléculaire
- 79 kDa (MW of target protein)
- Pathways
- Tube Formation
-