MAP4K2 anticorps (N-Term)

N° du produit ABIN634357

Détail du produit anti-MAP4K2 anticorps

Antigène: MAP4K2 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 2 (MAP4K2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAP4K2 est non-conjugé

Application: Western Blotting (WB)

Specificité: MAP4 K2 antibody was raised against the N terminal of MAP4 2

Purification: Affinity purified

Immunogène: MAP4 K2 antibody was raised using the N terminal of MAP4 2 corresponding to a region with amino acids HLHPMRALMLMSKSSFQPPKLRDKTRWTQNFHHFLKLALTKNPKKRPTAE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAP4K2 Blocking Peptide, catalog no. 33R-3778, is also available for use as a blocking control in assays to test for specificity of this MAP4K2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAP4K2

Antigène: MAP4K2 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 2 (MAP4K2))

Autre désignation: MAP4K2 (MAP4K2 Produits)

Synonymes: anticorps BL44, anticorps GCK, anticorps RAB8IP, anticorps AI385662, anticorps Rab8ip, anticorps MAP4K2, anticorps dZ150L22.2, anticorps map4k2l, anticorps map4k2l-2, anticorps map4k3l, anticorps si:dz150l22.2, anticorps si:dz263j20.1, anticorps zgc:136670, anticorps mitogen-activated protein kinase kinase kinase kinase 2, anticorps mitogen activated protein kinase kinase kinase kinase 2, anticorps MAP4K2, anticorps Map4k2, anticorps LOC103346779, anticorps map4k2

Sujet: MAP4K2 is a member of the serine/threonine protein kinase family. Although this kinase is found in many tissues, its expression in lymphoid follicles is restricted to the cells of germinal centre, where it may participate in B-cell differentiation. This kinase can be activated by TNF-alpha, and has been shown to specifically activate MAP kinases. This kinase is also found to interact with TNF receptor-associated factor 2 (TRAF2), which is involved in the activation of MAP3K1/MEKK1.

Poids moléculaire: 91 kDa (MW of target protein)