DDAH2 anticorps (N-Term)

N° du produit ABIN634365

Détail du produit anti-DDAH2 anticorps

Antigène: DDAH2 (Dimethylarginine Dimethylaminohydrolase 2 (DDAH2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDAH2 est non-conjugé

Application: Western Blotting (WB)

Specificité: DDAH2 antibody was raised against the N terminal of DDAH2

Purification: Affinity purified

Immunogène: DDAH2 antibody was raised using the N terminal of DDAH2 corresponding to a region with amino acids MYTLHTKRVKAAARQMWTSNLSKVRQSLKNVYHKCKIRHQDSTGYPTVTS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DDAH2 Blocking Peptide, catalog no. 33R-6631, is also available for use as a blocking control in assays to test for specificity of this DDAH2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDAH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DDAH2

Antigène: DDAH2 (Dimethylarginine Dimethylaminohydrolase 2 (DDAH2))

Autre désignation: DDAH2 (DDAH2 Produits)

Synonymes: anticorps ddah2, anticorps MGC84290, anticorps g6a, anticorps ddah, anticorps ng30, anticorps ddahii, anticorps MGC89103, anticorps DDAH2, anticorps DDAH, anticorps DDAHII, anticorps G6a, anticorps NG30, anticorps 1110003M04Rik, anticorps AU019324, anticorps AW413173, anticorps DDAH-2, anticorps Ddah, anticorps dimethylarginine dimethylaminohydrolase 2, anticorps dimethylarginine dimethylaminohydrolase 2 L homeolog, anticorps ddah2, anticorps ddah2.L, anticorps DDAH2, anticorps Ddah2

Sujet: DDAH2 hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. DDAH2 has therefore a role in nitric oxide generation.

Poids moléculaire: 31 kDa (MW of target protein)