ARL8A anticorps (Middle Region)
-
- Antigène Voir toutes ARL8A Anticorps
- ARL8A (ADP-Ribosylation Factor-Like 8A (ARL8A))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ARL8A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ARL8 A antibody was raised against the middle region of ARL8
- Purification
- Affinity purified
- Immunogène
- ARL8 A antibody was raised using the middle region of ARL8 corresponding to a region with amino acids IGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQ
- Top Product
- Discover our top product ARL8A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ARL8A Blocking Peptide, catalog no. 33R-3970, is also available for use as a blocking control in assays to test for specificity of this ARL8A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ARL8A (ADP-Ribosylation Factor-Like 8A (ARL8A))
- Autre désignation
- ARL8A (ARL8A Produits)
- Synonymes
- anticorps gie2, anticorps MGC75773, anticorps fe25e11, anticorps si:ch1073-204j4.2, anticorps wu:fe25e11, anticorps PTPN7, anticorps ARL10B, anticorps GIE2, anticorps 1110033P22Rik, anticorps Arl10b, anticorps RGD1565940, anticorps ADP ribosylation factor like GTPase 8A, anticorps ARF-like GTPase, anticorps ADP-ribosylation factor-like 8A, anticorps ADP-ribosylation factor like GTPase 8A, anticorps arl8a, anticorps ARL8A, anticorps ARL8a-2, anticorps ARL8a-1, anticorps Arl8a
- Sujet
- ARL8A belongs to the small GTPase superfamily, Arf family. ARL8A m,ay play a role in lysosomes motility. Alternatively, may play a role in chromosomes segregation.
- Poids moléculaire
- 21 kDa (MW of target protein)
-