RHEB anticorps (Middle Region)
-
- Antigène Voir toutes RHEB Anticorps
- RHEB (Ras Homolog Enriched in Brain (RHEB))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RHEB est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RHEB antibody was raised against the middle region of RHEB
- Purification
- Affinity purified
- Immunogène
- RHEB antibody was raised using the middle region of RHEB corresponding to a region with amino acids VGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTA
- Top Product
- Discover our top product RHEB Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RHEB Blocking Peptide, catalog no. 33R-9564, is also available for use as a blocking control in assays to test for specificity of this RHEB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHEB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RHEB (Ras Homolog Enriched in Brain (RHEB))
- Autre désignation
- RHEB (RHEB Produits)
- Synonymes
- anticorps RHEB2, anticorps RHEB, anticorps rheb2, anticorps CG1081, anticorps DReb, anticorps Dm Rheb, anticorps DmRheb, anticorps Dmel\CG1081, anticorps Q9VND8, anticorps RheB, anticorps dRheb, anticorps rheb, anticorps Ras homolog, mTORC1 binding, anticorps Ras homolog enriched in brain, anticorps ras homolog enriched in brain, anticorps Ras homolog, mTORC1 binding L homeolog, anticorps RHEB, anticorps Rheb, anticorps rheb, anticorps rheb.L
- Sujet
- This gene is a member of the small GTPase superfamily and encodes a lipid-anchored, cell membrane protein with five repeats of the RAS-related GTP-binding region.
- Poids moléculaire
- 20 kDa (MW of target protein)
- Pathways
- Signalisation RTK
-