RAB18 anticorps (C-Term)
-
- Antigène Voir toutes RAB18 Anticorps
- RAB18 (RAB18, Member RAS Oncogene Family (RAB18))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RAB18 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RAB18 antibody was raised against the C terminal of RAB18
- Purification
- Affinity purified
- Immunogène
- RAB18 antibody was raised using the C terminal of RAB18 corresponding to a region with amino acids LFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQG
- Top Product
- Discover our top product RAB18 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RAB18 Blocking Peptide, catalog no. 33R-4939, is also available for use as a blocking control in assays to test for specificity of this RAB18 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB18 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RAB18 (RAB18, Member RAS Oncogene Family (RAB18))
- Autre désignation
- RAB18 (RAB18 Produits)
- Sujet
- RAB18 belongs to the small GTPase superfamily.
- Poids moléculaire
- 23 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-