RRAD anticorps (Middle Region)

N° du produit ABIN634370

Détail du produit anti-RRAD anticorps

Antigène: RRAD (Ras-Related Associated with Diabetes (RRAD))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RRAD est non-conjugé

Application: Western Blotting (WB)

Specificité: RRAD antibody was raised against the middle region of RRAD

Purification: Affinity purified

Immunogène: RRAD antibody was raised using the middle region of RRAD corresponding to a region with amino acids LARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RRAD Blocking Peptide, catalog no. 33R-4793, is also available for use as a blocking control in assays to test for specificity of this RRAD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRAD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RRAD

Antigène: RRAD (Ras-Related Associated with Diabetes (RRAD))

Autre désignation: RRAD (RRAD Produits)

Synonymes: anticorps ZGC:63471, anticorps RRAD, anticorps RAD, anticorps RAD1, anticorps REM3, anticorps Rad, anticorps RRAD, Ras related glycolysis inhibitor and calcium channel regulator, anticorps Ras-related associated with diabetes, anticorps RRAD, anticorps Rrad

Sujet: RRAD may play an important role in cardiac antiarrhythmia via the strong suppression of voltage-gated L-type Ca2+ currents.

Poids moléculaire: 33 kDa (MW of target protein)