Uromodulin anticorps (Middle Region)
-
- Antigène Voir toutes Uromodulin (UMOD) Anticorps
- Uromodulin (UMOD)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Uromodulin est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Uromodulin antibody was raised against the middle region of UMOD
- Purification
- Affinity purified
- Immunogène
- Uromodulin antibody was raised using the middle region of UMOD corresponding to a region with amino acids MTNCYATPSSNATDPLKYFIIQDRCPHTRDSTIQVVENGESSQGRFSVQM
- Top Product
- Discover our top product UMOD Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Uromodulin Blocking Peptide, catalog no. 33R-6556, is also available for use as a blocking control in assays to test for specificity of this Uromodulin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UMOD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Uromodulin (UMOD)
- Autre désignation
- Uromodulin (UMOD Produits)
- Synonymes
- anticorps ADMCKD2, anticorps FJHN, anticorps HNFJ, anticorps HNFJ1, anticorps MCKD2, anticorps THGP, anticorps THP, anticorps urehr4, anticorps uromodulin, anticorps UMOD, anticorps Umod
- Sujet
- This gene encodes uromodulin, the most abundant protein in normal urine.
- Poids moléculaire
- 67 kDa (MW of target protein)
-