GUCY1B3 anticorps (N-Term)

N° du produit ABIN634375

Détail du produit anti-GUCY1B3 anticorps

Antigène: GUCY1B3 (Guanylate Cyclase 1, Soluble, beta 3 (GUCY1B3))

Épitope: N-Term

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GUCY1B3 est non-conjugé

Application: Western Blotting (WB)

Specificité: GUCY1 B3 antibody was raised against the N terminal of GUCY1 3

Purification: Affinity purified

Immunogène: GUCY1 B3 antibody was raised using the N terminal of GUCY1 3 corresponding to a region with amino acids LIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GUCY1B3 Blocking Peptide, catalog no. 33R-5041, is also available for use as a blocking control in assays to test for specificity of this GUCY1B3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GUCY0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GUCY1B3

Antigène: GUCY1B3 (Guanylate Cyclase 1, Soluble, beta 3 (GUCY1B3))

Autre désignation: GUCY1B3 (GUCY1B3 Produits)

Synonymes: anticorps GUCY1B3, anticorps AMGC1, anticorps AmsGC-beta1, anticorps AmsGCbeta1, anticorps GB20021, anticorps Gucy1b3, anticorps gucy1b3, anticorps GC-S-beta-1, anticorps GC-SB3, anticorps GUC1B3, anticorps GUCB3, anticorps GUCSB3, anticorps GUCY1B1, anticorps SGCB1, anticorps GCbeta1, anticorps Gucy1b1, anticorps SGC, anticorps guanylate cyclase 1 soluble subunit beta, anticorps guanylate cyclase 1, soluble, beta 3, anticorps guanylate cyclase, soluble, beta 1, anticorps guanylate cyclase 1, soluble, beta 3 S homeolog, anticorps guanylate cyclase 1 soluble subunit beta 3, anticorps GUCY1B3, anticorps gucy1b3, anticorps Gycbeta1, anticorps gucy1b3.S, anticorps Gucy1b3

Sujet: Soluble guanylate cyclase (sGC), a heterodimeric protein consisting of an alpha subunit and a beta subunit, typically GUCY1B3, catalyzes conversion of GTP to the second messenger cGMP and functions as the main receptor for nitric oxide (NO) and nitrovasodilator drugs.

Poids moléculaire: 70 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis