RASGRP2 anticorps

N° du produit ABIN634377

Détail du produit anti-RASGRP2 anticorps

Antigène: RASGRP2 (RAS Guanyl Releasing Protein 2 (Calcium and DAG-Regulated) (RASGRP2))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RASGRP2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: RASGRP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWIS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RASGRP2 Blocking Peptide, catalog no. 33R-5537, is also available for use as a blocking control in assays to test for specificity of this RASGRP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RASGRP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RASGRP2

Antigène: RASGRP2 (RAS Guanyl Releasing Protein 2 (Calcium and DAG-Regulated) (RASGRP2))

Autre désignation: RASGRP2 (RASGRP2 Produits)

Synonymes: anticorps CALDAG-GEFI, anticorps CDC25L, anticorps xrasgrp2, anticorps RASGRP2, anticorps Caldaggef1, anticorps CalDAG-GEFI, anticorps rasgrp2, anticorps RAS guanyl releasing protein 2, anticorps RAS guanyl releasing protein 2 (calcium and DAG-regulated) S homeolog, anticorps RAS, guanyl releasing protein 2, anticorps RAS guanyl releasing protein 2 (calcium and DAG-regulated) L homeolog, anticorps RASGRP2, anticorps rasgrp2.S, anticorps Rasgrp2, anticorps rasgrp2.L

Sujet: The protein encoded by this gene is a brain-enriched nucleotide exchanged factor that contains an N-terminal GEF domain, 2 tandem repeats of EF-hand calcium-binding motifs, and a C-terminal diacylglycerol/phorbol ester-binding domain.

Poids moléculaire: 69 kDa (MW of target protein)

Pathways: TCR Signaling