DGKA anticorps (N-Term)

N° du produit ABIN634379

Détail du produit anti-DGKA anticorps

Antigène: DGKA (Diacylglycerol Kinase, alpha 80kDa (DGKA))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DGKA est non-conjugé

Application: Western Blotting (WB)

Specificité: DGKA antibody was raised against the N terminal of DGKA

Purification: Affinity purified

Immunogène: DGKA antibody was raised using the N terminal of DGKA corresponding to a region with amino acids EGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSEL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DGKA Blocking Peptide, catalog no. 33R-2431, is also available for use as a blocking control in assays to test for specificity of this DGKA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGKA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DGKA

Antigène: DGKA (Diacylglycerol Kinase, alpha 80kDa (DGKA))

Autre désignation: DGKA (DGKA Produits)

Synonymes: anticorps DAGK, anticorps DAGK1, anticorps DGK-alpha, anticorps 80kDa, anticorps AW146112, anticorps Dagk1, anticorps dgka, anticorps zgc:136759, anticorps dagk, anticorps dagk1, anticorps dgk-alpha, anticorps diacylglycerol kinase alpha, anticorps diacylglycerol kinase, alpha, anticorps diacylglycerol kinase, alpha 80kDa, anticorps diacylglycerol kinase, alpha a, anticorps diacylglycerol kinase alpha S homeolog, anticorps DGKA, anticorps Dgka, anticorps dgkaa, anticorps Tsp_02164, anticorps dgka, anticorps dgka.S

Sujet: The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It acts as a modulator that competes with protein kinase C for the second messenger diacylglycerol in intracellular signaling pathways.

Poids moléculaire: 83 kDa (MW of target protein)