RASGEF1C anticorps (Middle Region)

N° du produit ABIN634380

Détail du produit anti-RASGEF1C anticorps

Antigène: RASGEF1C (RasGEF Domain Family, Member 1C (RASGEF1C))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RASGEF1C est non-conjugé

Application: Western Blotting (WB)

Specificité: RASGEF1 C antibody was raised against the middle region of RASGEF1

Purification: Affinity purified

Immunogène: RASGEF1 C antibody was raised using the middle region of RASGEF1 corresponding to a region with amino acids FLELAKQVGEFITWKQVECPFEQDASITHYLYTAPIFSEDGLYLASYESE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RASGEF1C Blocking Peptide, catalog no. 33R-2957, is also available for use as a blocking control in assays to test for specificity of this RASGEF1C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RASGEF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RASGEF1C

Antigène: RASGEF1C (RasGEF Domain Family, Member 1C (RASGEF1C))

Autre désignation: RASGEF1C (RASGEF1C Produits)

Synonymes: anticorps RASGEF1C, anticorps 9130006A14Rik, anticorps RasGEF domain family member 1C, anticorps RasGEF domain family, member 1C, anticorps RASGEF1C, anticorps Rasgef1c

Sujet: RASGEF1C is the guanine nucleotide exchange factor (GEF).

Poids moléculaire: 53 kDa (MW of target protein)