OTUD6B anticorps (Middle Region)
-
- Antigène Voir toutes OTUD6B Anticorps
- OTUD6B (OTU Domain Containing 6B (OTUD6B))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp OTUD6B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- OTUD6 B antibody was raised against the middle region of OTUD6
- Purification
- Affinity purified
- Immunogène
- OTUD6 B antibody was raised using the middle region of OTUD6 corresponding to a region with amino acids EIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVNIVTENC
- Top Product
- Discover our top product OTUD6B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
OTUD6B Blocking Peptide, catalog no. 33R-2473, is also available for use as a blocking control in assays to test for specificity of this OTUD6B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OTUD0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- OTUD6B (OTU Domain Containing 6B (OTUD6B))
- Autre désignation
- OTUD6B (OTUD6B Produits)
- Synonymes
- anticorps DUBA5, anticorps 2600013N14Rik, anticorps AU015433, anticorps RGD1310024, anticorps zgc:56305, anticorps duba5, anticorps DKFZp459J184, anticorps OTU domain containing 6B, anticorps OTU domain containing 6B S homeolog, anticorps OTU domain containing 6B L homeolog, anticorps OTUD6B, anticorps Otud6b, anticorps otud6b, anticorps otud6b.S, anticorps otud6b.L
- Sujet
- Deubiquitinating enzymes are proteases that specifically cleave ubiquitin linkages, negating the action of ubiquitin ligases. DUBA5 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.
- Poids moléculaire
- 37 kDa (MW of target protein)
-