CANT1 anticorps (Middle Region)
-
- Antigène Voir toutes CANT1 Anticorps
- CANT1 (Calcium Activated Nucleotidase 1 (CANT1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CANT1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CANT1 antibody was raised against the middle region of CANT1
- Purification
- Affinity purified
- Immunogène
- CANT1 antibody was raised using the middle region of CANT1 corresponding to a region with amino acids VAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEG
- Top Product
- Discover our top product CANT1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CANT1 Blocking Peptide, catalog no. 33R-9442, is also available for use as a blocking control in assays to test for specificity of this CANT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CANT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CANT1 (Calcium Activated Nucleotidase 1 (CANT1))
- Autre désignation
- CANT1 (CANT1 Produits)
- Synonymes
- anticorps DBQD, anticorps SCAN-1, anticorps SCAN1, anticorps SHAPY, anticorps 5830420C20Rik, anticorps Apy1h, anticorps D11Bwg0554e, anticorps Entpd8, anticorps Shapy, anticorps srapy, anticorps apyrase, anticorps xapy, anticorps cant1, anticorps entpd8, anticorps zgc:85724, anticorps CANT1, anticorps zgc:101021, anticorps calcium activated nucleotidase 1, anticorps calcium activated nucleotidase 1 L homeolog, anticorps calcium activated nucleotidase 1a, anticorps calcium activated nucleotidase 1b, anticorps CANT1, anticorps Cant1, anticorps cant1.L, anticorps cant1, anticorps cant1a, anticorps LOAG_01305, anticorps cant1b
- Sujet
- This protein encoded by this gene belongs to the apyrase family. It functions as a calcium-dependent nucleotidase with a preference for UDP. Mutations in this gene are associated with Desbuquois dysplasia with hand anomalies.
- Poids moléculaire
- 45 kDa (MW of target protein)
-