RASGRF1 anticorps (N-Term)

N° du produit ABIN634389

Détail du produit anti-RASGRF1 anticorps

Antigène: RASGRF1 (Ras Protein-Specific Guanine Nucleotide-Releasing Factor 1 (RASGRF1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RASGRF1 est non-conjugé

Application: Western Blotting (WB)

Specificité: RASGRF1 antibody was raised against the N terminal of RASGRF1

Purification: Affinity purified

Immunogène: RASGRF1 antibody was raised using the N terminal of RASGRF1 corresponding to a region with amino acids RELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RASGRF1 Blocking Peptide, catalog no. 33R-7877, is also available for use as a blocking control in assays to test for specificity of this RASGRF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RASGRF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RASGRF1

Antigène: RASGRF1 (Ras Protein-Specific Guanine Nucleotide-Releasing Factor 1 (RASGRF1))

Autre désignation: RASGRF1 (RASGRF1 Produits)

Synonymes: anticorps CDC25, anticorps CDC25L, anticorps GNRP, anticorps GRF1, anticorps GRF55, anticorps H-GRF55, anticorps PP13187, anticorps ras-GRF1, anticorps AI844718, anticorps CDC25Mm, anticorps Grf1, anticorps Grfbeta, anticorps P190-A, anticorps Ras-GRF1, anticorps p190, anticorps p190RhoGEF, anticorps cdc25, anticorps rasgrf1, anticorps Ras protein specific guanine nucleotide releasing factor 1, anticorps RAS protein-specific guanine nucleotide-releasing factor 1, anticorps Ras protein specific guanine nucleotide releasing factor 1 S homeolog, anticorps si:ch211-234p18.3, anticorps RASGRF1, anticorps Rasgrf1, anticorps rasgrf1.S, anticorps si:ch211-234p18.3, anticorps rasgrf1

Sujet: The protein encoded by this gene is a guanine nucleotide exchange factor (GEF) similar to the Saccharomyces cerevisiae CDC25 gene product. Functional analysis has demonstrated that this protein stimulates the dissociation of GDP from RAS protein.

Poids moléculaire: 54 kDa (MW of target protein)

Pathways: Signalisation RTK, Cycle Cellulaire, M Phase