IFIT5 anticorps (N-Term)

N° du produit ABIN634392

Détail du produit anti-IFIT5 anticorps

Antigène: IFIT5 (Interferon-Induced Protein with Tetratricopeptide Repeats 5 (IFIT5))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IFIT5 est non-conjugé

Application: Western Blotting (WB)

Specificité: IFIT5 antibody was raised against the N terminal of IFIT5

Purification: Affinity purified

Immunogène: IFIT5 antibody was raised using the N terminal of IFIT5 corresponding to a region with amino acids LEEAQKYTGKIGNVCKKLSSPSNYKLECPETDCEKGWALLKFGGKYYQKA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IFIT5 Blocking Peptide, catalog no. 33R-4886, is also available for use as a blocking control in assays to test for specificity of this IFIT5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFIT5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IFIT5

Antigène: IFIT5 (Interferon-Induced Protein with Tetratricopeptide Repeats 5 (IFIT5))

Autre désignation: IFIT5 (IFIT5 Produits)

Synonymes: anticorps ri58, anticorps DKFZp469M2320, anticorps P58, anticorps RI58, anticorps interferon induced protein with tetratricopeptide repeats 5, anticorps interferon induced protein with tetratricopeptide repeats 5 L homeolog, anticorps interferon-induced protein with tetratricopeptide repeats 5, anticorps IFIT5, anticorps ifit5.L, anticorps LOC100024963, anticorps LOC100151816, anticorps ifit5

Sujet: IFIT5 belongs to the IFIT family. It contains 8 TPR repeats. The exact function of IFIT5 remains unknown.

Poids moléculaire: 56 kDa (MW of target protein)