DIRAS1 anticorps (N-Term)

N° du produit ABIN634394

Détail du produit anti-DIRAS1 anticorps

Antigène: DIRAS1 (DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DIRAS1 est non-conjugé

Application: Western Blotting (WB)

Specificité: DIRAS1 antibody was raised against the N terminal of DIRAS1

Purification: Affinity purified

Immunogène: DIRAS1 antibody was raised using the N terminal of DIRAS1 corresponding to a region with amino acids PEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DIRAS1 Blocking Peptide, catalog no. 33R-7059, is also available for use as a blocking control in assays to test for specificity of this DIRAS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DIRAS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DIRAS1

Antigène: DIRAS1 (DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1))

Autre désignation: DIRAS1 (DIRAS1 Produits)

Synonymes: anticorps Di-Ras1, anticorps GBTS1, anticorps RIG, anticorps Gbts1, anticorps diras1, anticorps fi18d11, anticorps wu:fi18d11, anticorps zgc:55360, anticorps si:dkey-97k23.2, anticorps rig, anticorps gbts1, anticorps di-ras1, anticorps MGC146486, anticorps DIRAS family GTPase 1, anticorps DIRAS family, GTP-binding RAS-like 1, anticorps DIRAS family, GTP-binding RAS-like 1a, anticorps DIRAS family, GTP-binding RAS-like 1b, anticorps DIRAS family GTP binding RAS like 1, anticorps DIRAS1, anticorps Diras1, anticorps diras1a, anticorps diras1b, anticorps diras1

Sujet: DIRAS1 belongs to a distinct branch of the functionally diverse Ras superfamily of monomeric GTPases.

Poids moléculaire: 22 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly