RGS6 anticorps (C-Term)

N° du produit ABIN634403

Détail du produit anti-RGS6 anticorps

Antigène: RGS6 (Regulator of G-Protein Signaling 6 (RGS6))

Épitope: C-Term

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RGS6 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: RGS6 antibody was raised against the C terminal of RGS6

Purification: Affinity purified

Immunogène: RGS6 antibody was raised using the C terminal of RGS6 corresponding to a region with amino acids SAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAY

Information d'application

Indications d'application: WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RGS6 Blocking Peptide, catalog no. 33R-8297, is also available for use as a blocking control in assays to test for specificity of this RGS6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Références pour anticorps anti-RGS6 (ABIN634403)

Gao, Shen, Gonzalez, Dong, Kannan, Hoang, Eisinger, Pandey, Javadi, Chang, Wang, Overstreet-Wadiche, Zhao: "RGS6 Mediates Effects of Voluntary Running on Adult Hippocampal Neurogenesis." dans: Cell reports, Vol. 32, Issue 5, pp. 107997, (2020) (PubMed).

Détails sur RGS6

Antigène: RGS6 (Regulator of G-Protein Signaling 6 (RGS6))

Autre désignation: RGS6 (RGS6 Produits)

Synonymes: anticorps RGS6, anticorps DKFZp459O0734, anticorps GAP, anticorps hm:zeh0300, anticorps si:ch211-268e23.2, anticorps regulator of G protein signaling 6, anticorps regulator of G-protein signaling 6, anticorps regulator of G-protein signaling 6 S homeolog, anticorps RGS6, anticorps Rgs6, anticorps rgs6.S, anticorps rgs6

Sujet: Members of the RGS (regulator of G protein signaling) family, such as RGS6, modulate G protein function by activating the intrinsic GTPase activity of the alpha (guanine nucleotide-binding) subunits.

Poids moléculaire: 54 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling