RAB15 anticorps (N-Term)
-
- Antigène Voir toutes RAB15 Anticorps
- RAB15 (RAB15, Member RAS Onocogene Family (RAB15))
-
Épitope
- N-Term
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RAB15 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RAB15 antibody was raised against the N terminal of RAB15
- Purification
- Affinity purified
- Immunogène
- RAB15 antibody was raised using the N terminal of RAB15 corresponding to a region with amino acids SSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQERYQTITKQYYRRAQGI
- Top Product
- Discover our top product RAB15 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RAB15 Blocking Peptide, catalog no. 33R-8810, is also available for use as a blocking control in assays to test for specificity of this RAB15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RAB15 (RAB15, Member RAS Onocogene Family (RAB15))
- Autre désignation
- RAB15 (RAB15 Produits)
- Synonymes
- anticorps si:dkey-263p20.2, anticorps zgc:86635, anticorps 2310012G06Rik, anticorps AI840042, anticorps RAB15, member RAS oncogene family, anticorps RAB15, member RAS oncogene family S homeolog, anticorps rab15, anticorps rab15.S, anticorps RAB15, anticorps Rab15
- Sujet
- RAB15 may act in concert with RAB3A in regulating aspects of synaptic vesicle membrane flow within the nerve terminal.
- Poids moléculaire
- 23 kDa (MW of target protein)
-