RGS4 anticorps (C-Term)
-
- Antigène Voir toutes RGS4 Anticorps
- RGS4 (Regulator of G-Protein Signaling 4 (RGS4))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RGS4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RGS4 antibody was raised against the C terminal of RGS4
- Purification
- Affinity purified
- Immunogène
- RGS4 antibody was raised using the C terminal of RGS4 corresponding to a region with amino acids EAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASL
- Top Product
- Discover our top product RGS4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RGS4 Blocking Peptide, catalog no. 33R-2276, is also available for use as a blocking control in assays to test for specificity of this RGS4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RGS4 (Regulator of G-Protein Signaling 4 (RGS4))
- Autre désignation
- RGS4 (RGS4 Produits)
- Sujet
- Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 4 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. This protein negatively regulates signaling upstream or at the level of the heterotrimeric G protein and is localized in the cytoplasm.
- Poids moléculaire
- 23 kDa (MW of target protein)
- Pathways
- Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling
-