DUSP10 anticorps (N-Term)

N° du produit ABIN634409

Détail du produit anti-DUSP10 anticorps

Antigène: DUSP10 (Dual Specificity Phosphatase 10 (DUSP10))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DUSP10 est non-conjugé

Application: Western Blotting (WB)

Specificité: DUSP10 antibody was raised against the N terminal of DUSP10

Purification: Affinity purified

Immunogène: DUSP10 antibody was raised using the N terminal of DUSP10 corresponding to a region with amino acids MQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DUSP10 Blocking Peptide, catalog no. 33R-6340, is also available for use as a blocking control in assays to test for specificity of this DUSP10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DUSP10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DUSP10

Antigène: DUSP10 (Dual Specificity Phosphatase 10 (DUSP10))

Autre désignation: DUSP10 (DUSP10 Produits)

Synonymes: anticorps DUSP10, anticorps MKP-5, anticorps MKP5, anticorps 2610306G15Rik, anticorps AI158871, anticorps Mkp-5, anticorps Mkp5, anticorps dual specificity phosphatase 10, anticorps DUSP10, anticorps Dusp10

Sujet: Dual specificity protein phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues.

Poids moléculaire: 16 kDa (MW of target protein)