Pleckstrin anticorps (N-Term)

N° du produit ABIN634412

Détail du produit anti-Pleckstrin anticorps

Antigène: Pleckstrin (PLEK)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Pleckstrin est non-conjugé

Application: Western Blotting (WB)

Specificité: PLEK antibody was raised against the N terminal of PLEK

Purification: Affinity purified

Immunogène: PLEK antibody was raised using the N terminal of PLEK corresponding to a region with amino acids MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PLEK Blocking Peptide, catalog no. 33R-5943, is also available for use as a blocking control in assays to test for specificity of this PLEK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLEK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Pleckstrin

Antigène: Pleckstrin (PLEK)

Autre désignation: PLEK (PLEK Produits)

Synonymes: anticorps MGC69065, anticorps PLEK, anticorps P47, anticorps 2010300B13Rik, anticorps pleckstrin L homeolog, anticorps pleckstrin, anticorps plek.L, anticorps PLEK, anticorps Plek

Sujet: PLEK is a major protein kinase C substrate of platelets, its exact function is not known.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Inositol Metabolic Process, Regulation of G-Protein Coupled Receptor Protein Signaling, Regulation of Cell Size, Regulation of Carbohydrate Metabolic Process