Pkc beta 1 anticorps (N-Term)

N° du produit ABIN634421

Détail du produit anti-Pkc beta 1 anticorps

Antigène: Pkc beta 1 (Protein Kinase C, beta 1 (Pkc beta 1))

Épitope: N-Term

Reactivité: Rat, Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Pkc beta 1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PRKCB1 antibody was raised against the N terminal of PRKCB1

Purification: Affinity purified

Immunogène: PRKCB1 antibody was raised using the N terminal of PRKCB1 corresponding to a region with amino acids MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRKCB1 Blocking Peptide, catalog no. 33R-5625, is also available for use as a blocking control in assays to test for specificity of this PRKCB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKCB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Pkc beta 1

Antigène: Pkc beta 1 (Protein Kinase C, beta 1 (Pkc beta 1))

Autre désignation: PRKCB1 (Pkc beta 1 Produits)

Synonymes: anticorps PKC-beta, anticorps PKCB, anticorps PRKCB1, anticorps PRKCB2, anticorps A130082F03Rik, anticorps PKC-Beta, anticorps Pkcb, anticorps Prkcb1, anticorps Prkcb2, anticorps PKC, anticorps PRKCB_tv2, anticorps protein kinase C beta, anticorps protein kinase C, beta, anticorps PRKCB, anticorps Prkcb

Sujet: Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets.

Poids moléculaire: 77 kDa (MW of target protein)