PKC gamma anticorps (Middle Region)
-
- Antigène Voir toutes PKC gamma (PRKCG) Anticorps
- PKC gamma (PRKCG) (Protein Kinase C, gamma (PRKCG))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PKC gamma est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PRKCG antibody was raised against the middle region of PRKCG
- Purification
- Affinity purified
- Immunogène
- PRKCG antibody was raised using the middle region of PRKCG corresponding to a region with amino acids WSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKG
- Top Product
- Discover our top product PRKCG Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PRKCG Blocking Peptide, catalog no. 33R-10011, is also available for use as a blocking control in assays to test for specificity of this PRKCG antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKCG antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PKC gamma (PRKCG) (Protein Kinase C, gamma (PRKCG))
- Autre désignation
- PRKCG (PRKCG Produits)
- Synonymes
- anticorps PRKCG, anticorps PKC-gamma, anticorps PKCC, anticorps PKCG, anticorps SCA14, anticorps PKCgamma, anticorps Pkcc, anticorps Prkcc, anticorps PKC, anticorps PKCI, anticorps Prkc, anticorps RATPKCI, anticorps protein kinase C gamma, anticorps protein kinase C, gamma, anticorps protein kinase C gamma type, anticorps PRKCG, anticorps Prkcg, anticorps LOC484316
- Sujet
- Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets.
- Poids moléculaire
- 78 kDa (MW of target protein)
- Pathways
- Signalisation WNT, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction, G-protein mediated Events, Positive Regulation of Response to DNA Damage Stimulus, Interaction of EGFR with phospholipase C-gamma, Thromboxane A2 Receptor Signaling, VEGF Signaling
-