PLCD1 anticorps (N-Term)

N° du produit ABIN634425

Détail du produit anti-PLCD1 anticorps

Antigène: PLCD1 (phospholipase C, delta 1 (PLCD1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PLCD1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PLCD1 antibody was raised against the N terminal of PLCD1

Purification: Affinity purified

Immunogène: PLCD1 antibody was raised using the N terminal of PLCD1 corresponding to a region with amino acids DIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PLCD1 Blocking Peptide, catalog no. 33R-2003, is also available for use as a blocking control in assays to test for specificity of this PLCD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLCD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PLCD1

Antigène: PLCD1 (phospholipase C, delta 1 (PLCD1))

Autre désignation: PLCD1 (PLCD1 Produits)

Synonymes: anticorps NDNC3, anticorps PLC-III, anticorps AW212592, anticorps C79986, anticorps Plc1, anticorps phospholipase C delta 1, anticorps phospholipase C, delta 1, anticorps 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1, anticorps PLCD1, anticorps Plcd1, anticorps LOC790012

Sujet: Phosphoinositide-specific phospholipase C (PLC) acts as a signal transducer that generates 2 second messengers, diacylglycerol and inositol 1,4,5-trisphosphate, by hydrolyzing inositol phospholipids. PLC comprises a diverse family of enzymes that differ in structure and tissue distribution.

Poids moléculaire: 86 kDa (MW of target protein)

Pathways: Signalisation WNT, Myometrial Relaxation and Contraction, Regulation of Carbohydrate Metabolic Process