RASL10A anticorps (N-Term)

N° du produit ABIN634426

Détail du produit anti-RASL10A anticorps

Antigène: RASL10A (RAS-Like, Family 10, Member A (RASL10A))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RASL10A est non-conjugé

Application: Western Blotting (WB)

Specificité: RASL10 A antibody was raised against the N terminal of RASL10

Purification: Affinity purified

Immunogène: RASL10 A antibody was raised using the N terminal of RASL10 corresponding to a region with amino acids PTDGPRLYRPAVLLDGAVYDLSIRDGDVAGPGSSPGGPEEWPDAKDWSLQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RASL10A Blocking Peptide, catalog no. 33R-7384, is also available for use as a blocking control in assays to test for specificity of this RASL10A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RASL10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RASL10A

Antigène: RASL10A (RAS-Like, Family 10, Member A (RASL10A))

Autre désignation: RASL10A (RASL10A Produits)

Synonymes: anticorps RRP22, anticorps 2210403B10Rik, anticorps AI852688, anticorps RGD1306100, anticorps RAS like family 10 member A, anticorps RAS-like, family 10, member A, anticorps RASL10A, anticorps Rasl10a

Sujet: The specific function of RASL10A is not yet known.

Poids moléculaire: 22 kDa (MW of target protein)