RAB40A anticorps (Middle Region)
-
- Antigène Voir toutes RAB40A Anticorps
- RAB40A (RAB40A, Member RAS Oncogene Family (RAB40A))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RAB40A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RAB40 A antibody was raised against the middle region of RAB40
- Purification
- Affinity purified
- Immunogène
- RAB40 A antibody was raised using the middle region of RAB40 corresponding to a region with amino acids RPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNAR
- Top Product
- Discover our top product RAB40A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RAB40A Blocking Peptide, catalog no. 33R-8107, is also available for use as a blocking control in assays to test for specificity of this RAB40A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB40 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RAB40A (RAB40A, Member RAS Oncogene Family (RAB40A))
- Autre désignation
- RAB40A (RAB40A Produits)
- Synonymes
- anticorps RAR2, anticorps RAR2A, anticorps RAB40A, member RAS oncogene family, anticorps RAB40A
- Sujet
- RAB40A belongs to the small GTPase superfamily, Rab family. It contains 1 SOCS box domain. RAB40A may be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
- Poids moléculaire
- 31 kDa (MW of target protein)
-