RAB40B anticorps (Middle Region)

N° du produit ABIN634429

Détail du produit anti-RAB40B anticorps

Antigène: RAB40B (RAB40B, Member RAS Oncogene Family (RAB40B))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAB40B est non-conjugé

Application: Western Blotting (WB)

Specificité: RAB40 B antibody was raised against the middle region of RAB40

Purification: Affinity purified

Immunogène: RAB40 B antibody was raised using the middle region of RAB40 corresponding to a region with amino acids YAERLGVTFFEVSPLCNFNITESFTELARIVLLRHGMDRLWRPSKVLSLQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAB40B Blocking Peptide, catalog no. 33R-10045, is also available for use as a blocking control in assays to test for specificity of this RAB40B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAB40B

Antigène: RAB40B (RAB40B, Member RAS Oncogene Family (RAB40B))

Autre désignation: RAB40B (RAB40B Produits)

Synonymes: anticorps rab40, anticorps rar, anticorps sec4l, anticorps xrab40, anticorps zgc:92926, anticorps MGC145203, anticorps RAR, anticorps SEC4L, anticorps RAB40B, anticorps RAB40B, member RAS oncogene family L homeolog, anticorps RAB40B, member RAS oncogene family, anticorps Rab40B, member RAS oncogene family, anticorps Rab40b, member RAS oncogene family, anticorps rab40b.L, anticorps rab40b, anticorps RAB40B, anticorps Rab40b

Sujet: RAB40B has similarity to a yeast protein which suggests a role of the gene product in regulating secretory vesicles.

Poids moléculaire: 31 kDa (MW of target protein)