RABL4 anticorps (C-Term)

N° du produit ABIN634436

Détail du produit anti-RABL4 anticorps

Antigène: RABL4 (IFT27) (Intraflagellar Transport 27 Homolog (IFT27))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RABL4 est non-conjugé

Application: Western Blotting (WB)

Specificité: RABL4 antibody was raised against the C terminal of RABL4

Purification: Affinity purified

Immunogène: RABL4 antibody was raised using the C terminal of RABL4 corresponding to a region with amino acids RAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RABL4 Blocking Peptide, catalog no. 33R-7831, is also available for use as a blocking control in assays to test for specificity of this RABL4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RABL4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RABL4

Antigène: RABL4 (IFT27) (Intraflagellar Transport 27 Homolog (IFT27))

Autre désignation: RABL4 (IFT27 Produits)

Synonymes: anticorps 2600013G09Rik, anticorps Rabl4, anticorps RABL4, anticorps RAYL, anticorps intraflagellar transport 27, anticorps Ift27, anticorps IFT27

Sujet: RABL4 belongs to the small GTPase superfamily, Ras family. RABL4 possesses GTPase activity By similarity.

Poids moléculaire: 20 kDa (MW of target protein)

Pathways: Signalisation Hedgehog