Calcyphosine anticorps (N-Term)

N° du produit ABIN634437

Détail du produit anti-Calcyphosine anticorps

Antigène: Calcyphosine (CAPS)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Calcyphosine est non-conjugé

Application: Western Blotting (WB)

Specificité: CAPS antibody was raised against the N terminal of CAPS

Purification: Affinity purified

Immunogène: CAPS antibody was raised using the N terminal of CAPS corresponding to a region with amino acids DAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CAPS Blocking Peptide, catalog no. 33R-1864, is also available for use as a blocking control in assays to test for specificity of this CAPS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAPS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Calcyphosine

Antigène: Calcyphosine (CAPS)

Autre désignation: CAPS (CAPS Produits)

Synonymes: anticorps CAPS1, anticorps Caps, anticorps Caps1, anticorps Caps2, anticorps caps1, anticorps MGC84373, anticorps CAPS, anticorps calcyphosine, anticorps calcium dependent secretion activator, anticorps calcyphosine S homeolog, anticorps CAPS, anticorps Cadps, anticorps caps.S, anticorps caps, anticorps Caps

Sujet: CAPS is a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit.

Poids moléculaire: 21 kDa (MW of target protein)