TBL3 anticorps
-
- Antigène Voir toutes TBL3 Anticorps
- TBL3 (Transducin (Beta)-Like 3 (TBL3))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TBL3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- TBL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAETAAGVGRFKTNYAVERKIEPFYKGGKAQLDQTGQHLFCVCGTRVNIL
- Top Product
- Discover our top product TBL3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TBL3 Blocking Peptide, catalog no. 33R-5646, is also available for use as a blocking control in assays to test for specificity of this TBL3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBL3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TBL3 (Transducin (Beta)-Like 3 (TBL3))
- Autre désignation
- TBL3 (TBL3 Produits)
- Synonymes
- anticorps MGC69179, anticorps zgc:101778, anticorps AmCG7589, anticorps GB11903, anticorps SAZD, anticorps UTP13, anticorps 9430070M15Rik, anticorps transducin (beta)-like 3 L homeolog, anticorps transducin beta like 3, anticorps transducin (beta)-like 3, anticorps transducin beta-like protein 3, anticorps tbl3.L, anticorps TBL3, anticorps tbl3, anticorps LOC724596, anticorps Tbl3
- Sujet
- The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function.
- Poids moléculaire
- 89 kDa (MW of target protein)
-