ACOT11 anticorps (Middle Region)
-
- Antigène Voir toutes ACOT11 Anticorps
- ACOT11 (Acyl-CoA Thioesterase 11 (ACOT11))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACOT11 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ACOT11 antibody was raised against the middle region of ACOT11
- Purification
- Affinity purified
- Immunogène
- ACOT11 antibody was raised using the middle region of ACOT11 corresponding to a region with amino acids YVIALRSVTLPTHRETPEYRRGETLCSGFCLWREGDQLTKCCWVRVSLTE
- Top Product
- Discover our top product ACOT11 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ACOT11 Blocking Peptide, catalog no. 33R-10276, is also available for use as a blocking control in assays to test for specificity of this ACOT11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACOT11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ACOT11 (Acyl-CoA Thioesterase 11 (ACOT11))
- Autre désignation
- ACOT11 (ACOT11 Produits)
- Synonymes
- anticorps BFIT, anticorps STARD14, anticorps THEA, anticorps THEM1, anticorps 1110020M10Rik, anticorps 2010309H15Rik, anticorps AW060409, anticorps BFIT1, anticorps Thea, anticorps Them1, anticorps mKIAA0707, anticorps acot11, anticorps zgc:113011, anticorps ACOT11, anticorps DKFZp469E1816, anticorps acyl-CoA thioesterase 11, anticorps acyl-CoA thioesterase 11a, anticorps acyl-CoA thioesterase 11 L homeolog, anticorps ACOT11, anticorps Acot11, anticorps acot11a, anticorps acot11.L, anticorps acot11
- Sujet
- ACOT11 is a protein with acyl-CoA thioesterase activity towards medium (C12) and long-chain (C18) fatty acyl-CoA substrates. Expression of a similar murine protein in brown adipose tissue is induced by cold exposure and repressed by warmth. Expression of the mouse protein has been associated with obesity, with higher expression found in obesity-resistant mice compared with obesity-prone mice.
- Poids moléculaire
- 68 kDa (MW of target protein)
-