RAB5B anticorps (N-Term)

N° du produit ABIN634446

Détail du produit anti-RAB5B anticorps

Antigène: RAB5B (RAB5B, Member RAS Oncogene Family (RAB5B))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAB5B est non-conjugé

Application: Western Blotting (WB)

Specificité: RAB5 B antibody was raised against the N terminal of RAB5

Purification: Affinity purified

Immunogène: RAB5 B antibody was raised using the N terminal of RAB5 corresponding to a region with amino acids MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAB5B Blocking Peptide, catalog no. 33R-6565, is also available for use as a blocking control in assays to test for specificity of this RAB5B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAB5B

Antigène: RAB5B (RAB5B, Member RAS Oncogene Family (RAB5B))

Autre désignation: RAB5B (RAB5B Produits)

Synonymes: anticorps zgc:76978, anticorps C030027M18Rik, anticorps RAB5B, member RAS oncogene family, anticorps RAB5B, member RAS oncogene family L homeolog, anticorps rab5b, anticorps LOC613071, anticorps RAB5B, anticorps Rab5b, anticorps rab5b.L

Sujet: RAB5B play a role in protein transport. RAB5B is probably involved in vesicular traffic.

Poids moléculaire: 24 kDa (MW of target protein)