ARF1 anticorps (Middle Region)
-
- Antigène Voir toutes ARF1 Anticorps
- ARF1 (ADP-Ribosylation Factor 1 (ARF1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ARF1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ARF1 antibody was raised against the middle region of ARF1
- Purification
- Affinity purified
- Immunogène
- ARF1 antibody was raised using the middle region of ARF1 corresponding to a region with amino acids MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA
- Top Product
- Discover our top product ARF1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ARF1 Blocking Peptide, catalog no. 33R-6371, is also available for use as a blocking control in assays to test for specificity of this ARF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ARF1 (ADP-Ribosylation Factor 1 (ARF1))
- Autre désignation
- ARF1 (ARF1 Produits)
- Synonymes
- anticorps wu:fb33e02, anticorps wu:fb78h01, anticorps arf2, anticorps arf-1, anticorps MGC52573, anticorps ADP-RIBOSYLATION FACTOR, anticorps ADP-RIBOSYLATION FACTOR 1A, anticorps ADP-ribosylation factor 1, anticorps ATARF, anticorps ATARF1, anticorps ATARFA1A, anticorps F28C11.12, anticorps ARF1, anticorps arf1, anticorps ADP ribosylation factor 1, anticorps ADP-ribosylation factor 1, anticorps ADP ribosylation factor 1 L homeolog, anticorps ADP ribosylation factor 5 L homeolog, anticorps ADP ribosylation factor 1 pseudogene, anticorps adp-ribosylation factor 1, anticorps ARF1, anticorps Arf1, anticorps arf1, anticorps arf1.L, anticorps arf5.L, anticorps NCU08340, anticorps TRIADDRAFT_63238, anticorps PAAG_08805, anticorps LOC100280562, anticorps LOC100280918, anticorps LOC474591, anticorps CLUG_01013
- Sujet
- ADP-ribosylation factor 1 (ARF1) is a member of the human ARF family. The family is composed of small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. These protein, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization.
- Poids moléculaire
- 21 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis, Inositol Metabolic Process
-