SOCS1 anticorps (Middle Region)
-
- Antigène Voir toutes SOCS1 Anticorps
- SOCS1 (Suppressor of Cytokine Signaling 1 (SOCS1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SOCS1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SOCS1 antibody was raised against the middle region of SOCS1
- Purification
- Affinity purified
- Immunogène
- SOCS1 antibody was raised using the middle region of SOCS1 corresponding to a region with amino acids RQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVA
- Top Product
- Discover our top product SOCS1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SOCS1 Blocking Peptide, catalog no. 33R-8127, is also available for use as a blocking control in assays to test for specificity of this SOCS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SOCS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SOCS1 (Suppressor of Cytokine Signaling 1 (SOCS1))
- Autre désignation
- SOCS1 (SOCS1 Produits)
- Synonymes
- anticorps socs1, anticorps zgc:91868, anticorps jab, anticorps cis1, anticorps ssi1, anticorps tip3, anticorps cish1, anticorps ssi-1, anticorps socs-1, anticorps SOCS1, anticorps LOC100228306, anticorps socs1b, anticorps CIS1, anticorps CISH1, anticorps JAB, anticorps SOCS-1, anticorps SSI-1, anticorps SSI1, anticorps TIP3, anticorps Cish1, anticorps Cish7, anticorps Socs-1, anticorps suppressor of cytokine signaling 1a, anticorps suppressor of cytokine signaling 1, anticorps suppressor of cytokine signaling 1 L homeolog, anticorps socs1a, anticorps socs1, anticorps SOCS1, anticorps socs1.L, anticorps Socs1
- Sujet
- SOCS1 is a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. SOCS1 functions downstream of cytokine receptors, and takes part in a negative feedback loop to attenuate cytokine signaling. Knockout studies in mice suggested the role of its gene as a modulator of IFN-gamma action, which is required for normal postnatal growth and survival.
- Poids moléculaire
- 23 kDa (MW of target protein)
- Pathways
- Signalistation JAK/STAT, Interferon-gamma Pathway, Signalisation TLR, Response to Growth Hormone Stimulus
-